The fragmentomic-assisted method was employed to predict the biological potential of peptides derived from milk proteins hydrolyzed by papain and bromelain. Firstly, protein sequences were acquired from the BIOPEP-UWM database and then hydrolyzed by the above enzymes using a BIOPEP-UWM tool called “Enzyme(s) action”. The released peptides were defined as parent peptides and further analyzed for the presence of shorter peptidic regions with documented bioactivity as well as their likelihood to be bioactive. The results revealed the bioactive potential of the released parent peptides. β-Casein was found as the best source of biopeptides. Although this finding is consistent with literature data, the new parent peptide i.e., PVQPFTESQSLTLTDVENLHLPPLLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSK, produced by the action of bromelain might be considered as a new strategic zone due to the presence of multi-active regions. Some parent peptides theoretically produced from milk proteins turned out to be fully bioactive. Despite the usefulness of the tools for peptide bioactivity prediction, the critical thinking while planning the application of such data in future experiments would thus appear to be a worthwhile line of inquiry.
Autorzy
- prof. dr hab inż. Anna Iwaniak,
- Antoni Taraszkiewicz link otwiera się w nowej karcie
Informacje dodatkowe
- DOI
- Cyfrowy identyfikator dokumentu elektronicznego link otwiera się w nowej karcie 10.31648/pjns.7726
- Kategoria
- Publikacja w czasopiśmie
- Typ
- artykuły w czasopismach
- Język
- angielski
- Rok wydania
- 2022
Źródło danych: MOSTWiedzy.pl - publikacja "Fragmentomic analysis of biopeptides in silico released from milk proteins" link otwiera się w nowej karcie